Rabbit Polyclonal Anti-SRP19 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRP19 antibody: synthetic peptide directed towards the middle region of human SRP19. Synthetic peptide located within the following region: LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK |
Rabbit Polyclonal Anti-SRP68 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRP68 antibody: synthetic peptide directed towards the N terminal of human SRP68. Synthetic peptide located within the following region: EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG |
Rabbit Polyclonal Anti-SRPR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRPR antibody: synthetic peptide directed towards the middle region of human SRPR. Synthetic peptide located within the following region: EEFIQKHGRGMEKSNKSTKSDAPKEKGKKAPRVWELGGCANKEVLDYSTP |
Germany
Japan
United Kingdom
China
