Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Rabbit Polyclonal Anti-CXCL16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the middle region of human LEP. Synthetic peptide located within the following region: LHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDM |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-IL8RB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-GH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GH2 antibody: synthetic peptide directed towards the middle region of human GH2. Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC |
Rabbit Polyclonal Anti-PF4V1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE |
Rabbit Polyclonal Anti-IL18RAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC |
Rabbit Polyclonal Anti-IL28RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV |
Germany
Japan
United Kingdom
China
