Antibodies for $/€ 289

Jump to Filters
View as table Download
ketohexokinase (KHK) Rabbit Polyclonal Antibody
TA346029

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
ketohexokinase (KHK) Rabbit Polyclonal Antibody
TA346115

USD 475.00

5 Days

Rabbit Polyclonal Anti-KHK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV