Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit Polyclonal Anti-ATG4D Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4D antibody: synthetic peptide directed towards the middle region of human ATG4D. Synthetic peptide located within the following region: AQGAPELEQERRHRQIVSWFADHPRAPFGLHRLVELGQSSGKKAGDWYGP |
Rabbit Polyclonal Anti-ATG4C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS |
Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS |
Germany
Japan
United Kingdom
China
