Rabbit Polyclonal Anti-ARIH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Arih2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Arih2. Synthetic peptide located within the following region: YYMESGPRKKLFEYQQAQLEAEIENLSWKVERADSYDRGDLENQMHIAEQ |
Rabbit Polyclonal Anti-ARIH2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARIH2 antibody: synthetic peptide directed towards the N terminal of human ARIH2. Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG |
Germany
Japan
United Kingdom
China