Primary Antibodies

Jump to Filters
View as table Download
TRPV5 Rabbit Polyclonal Antibody
TA328743

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-TRPV5

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GLNLSEGDGEEVYHF, corresponding to amino acid residues 715-729 of human TRPV5. Intracellular, C-terminus.
TRPV5 Rabbit Polyclonal Antibody
TA331092

USD 375.00

5 Days

Rabbit polyclonal Anti-TRPV5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA
TRPV5 Rabbit Polyclonal Antibody
TA351861

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRPV5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPV5