ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Anti-CFTR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR. |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Rabbit Polyclonal Anti-CFTR
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part. |
ABCG1 rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 366~395 from the Center region of Human ABCG1 |
ABCD1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of human ABCD1. |
ABCB5 (N-term) rabbit polyclonal antibody, Ig Fraction
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | ABCB5 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human ABCB5. |
MRP3 (ABCC3) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 906-933 amino acids from the Central region of human ABCC3. |
Rabbit Polyclonal ABCB5 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human ABCB5 protein (between residues 450-500) [UniProt Q2M3G0] |
Rabbit polyclonal anti-ABCB7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB7. |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal Anti-ABCC8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Rabbit Polyclonal ABCG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844] |
ABCG2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ABCB5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
ABCC10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 767-793 amino acids from the Central region of human ABCC10 |
ABCD2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 552-582 amino acids from the C-terminal region of human ABCD2. |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Rabbit Polyclonal Anti-ABCA5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI |
P Glycoprotein (ABCB1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (93%); Mouse, Rat, Hamster, Cat, Dog, Pig (80%). |
Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Hamster (82%). |
Anti-ABCC12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 11-25 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 12 |
Anti-ABCG5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 18-30 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 5 |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Anti-ABCB8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 394-693 amino acids of Human ATP-binding cassette sub-family B member 8 |
Anti-ABCC5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C? |
Anti-ABCB6 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCB6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 590-824 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 6 |
Anti-ABCD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 274-288 amino acids of human ATP-binding cassette, sub-family D (ALD), member 2 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 625-638 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Anti-ABCC3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 881-894 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 3 |
Anti-ABCB11 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11 |
Anti-ABCB11 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1308-1321 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 11 |
Anti-ABCA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 113-127 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 2 |
Anti-CFTR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator |
Anti-CFTR Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 681-897 amino acids of Human Cystic fibrosis transmembrane conductance regulator |
Anti-ABCA4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2260-2273 amino acids of human ATP-binding cassette, sub-family A (ABC1), member 4 |
Anti-ABCB5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-812 amino acids of Human ATP-binding cassette sub-family B member 5 |
Anti-ABCB5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 563-812 amino acids of Human ATP-binding cassette sub-family B member 5 |
Anti-ABCC10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 840-853 amino acids of human ATP-binding cassette, sub-family C (CFTR/MRP), member 10 |
Anti-ABCB9 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ABCB9, swissprot No.:Q9NP78-2. |
Rabbit Polyclonal Anti-ABCB7 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABCB7 |
Rabbit Polyclonal Anti-ABCB1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCB1 |
Rabbit Polyclonal Anti-ABCC2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC2 |