Rabbit Polyclonal BACE2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2. |
Rabbit Polyclonal BACE2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2. |
BACE2 (44-59) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | BACE2 antibody was raised against synthetic peptide (aptpgpgtpaerhadg) corresponding to amino acids 44 to 59 of human BACE2 |
BACE2 (N-term) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal BACE2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | BACE2 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BACE2. |
Rabbit Polyclonal Anti-BACE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF |
Rabbit Polyclonal Anti-BACE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG |
BACE2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BACE2 |
BACE2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 240-470 of human BACE2 (NP_036237.2). |
Modifications | Unmodified |