Primary Antibodies

View as table Download

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565]

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

CANX rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CANX

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Rabbit Polyclonal anti-CANX Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH.

Calnexin (CANX) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen CANX antibody was raised against synthetic peptide derived from sequence near the amino-terminus of canine Calnexin, conjugated to KLH

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal anti-CANX Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Anti-Calnexin -CT Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak)
Conjugation Unconjugated
Immunogen Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Anti-CANX Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CANX antibody: synthetic peptide directed towards the C terminal of human CANX. Synthetic peptide located within the following region: RPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEE

Rabbit Polyclonal Anti-CANX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANX antibody: synthetic peptide directed towards the middle region of human CANX. Synthetic peptide located within the following region: LVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK

Rabbit Polyclonal Anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CANX

CANX rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CANX

CANX rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CANX

Calnexin Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 501-592 of human Calnexin (NP_001737.1).
Modifications Unmodified

Calnexin Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Calnexin. AA range:543-592

Calnexin Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated