Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF

HNRNPU rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HNRNPU

Rabbit Polyclonal Anti-HNRNPU Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the N terminal of human HNRNPU. Synthetic peptide located within the following region: NGAAGAADSGPMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHG

hnRNP U Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 608-825 of human hnRNP U (NP_114032.2).
Modifications Unmodified