Primary Antibodies

View as table Download

Rabbit polyclonal anti-FKBP38 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 344 of mouse FKBP38

Rabbit Polyclonal antibody to FKBP8 (FK506 binding protein 8, 38kDa)

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 42 and 276 of FKBP8

Rabbit polyclonal anti-FKBP8 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human FKBP8 protein.

Rabbit Polyclonal Anti-FKBP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the N terminal of human FKBP8. Synthetic peptide located within the following region: GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS

Rabbit Polyclonal Anti-FKBP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the C terminal of human FKBP8. Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL

Rabbit Polyclonal Anti-FKBP8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FKBP8

FKBP8 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FKBP8

FKBP38/FKBP8 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human FKBP38/FKBP38/FKBP8 (NP_036313.3).
Modifications Unmodified