Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM33 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM33 antibody: synthetic peptide directed towards the middle region of human TRIM33. Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK

Rabbit Polyclonal TRIM33 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIM33 antibody was raised against an 18 amino acid peptide near the center of human TRIM33.

Rabbit Polyclonal Anti-TRIM33 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIM33