Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ERCC8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

Rabbit Polyclonal Anti-ERCC8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE

Rabbit Polyclonal Anti-ERCC8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT

Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD

ERCC8 (106-300) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Recombinant protein fragment corresponding to a region within amino acids 106 and 300 of CSA

ERCC8 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 210-238 amino acids from the Central region of Human ERCC8

Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216)

Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216)

Rabbit Polyclonal anti-ERCC8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG

Rabbit Polyclonal Anti-ERCC8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA