Rabbit polyclonal anti-HLX1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLX1. |
Rabbit polyclonal anti-HLX1 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLX1. |
Rabbit Polyclonal Anti-HLX Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLX antibody: synthetic peptide directed towards the middle region of human HLX. Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG |
Rabbit Polyclonal Anti-HLX Antibody
Applications | IF, WB |
Reactivities | Human, Xenopus |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR |