Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide mapping at the N-terminus of NMDAR2B of human origin |
Rabbit polyclonal anti-FCGR2A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FCGR2A. |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Rabbit polyclonal CD28 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B |
Rabbit Polyclonal NMDAR2B (Tyr1336) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1336 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR2B (Tyr1474) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1474 |
| Modifications | Phospho-specific |
Rabbit polyclonal GRIN2B (Phospho-Ser1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal CD32 (Phospho-Tyr292) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD32 around the phosphorylation site of tyrosine 292 (I-T-YP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal FCGR2C antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FCGR2C. |
Rabbit Polyclonal TNFA Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Active filters
Antibody Hosts
- Rabbit
Families
- Transmembrane
Pathways
- Systemic lupus erythematosus
Filter by
Category
Target Symbol
- GRIN2B (16)
- TNF (9)
- CD40 (8)
- GRIN2A (8)
- CD40LG (6)
- FCGR2B (4)
- HLA-DMB (3)
- HLA-DRA (3)
- HLA-DRB3 (3)
- C8B (2)
- CD80 (2)
- CD86 (2)
- FCGR1A (2)
- FCGR2A (2)
- FCGR2C (2)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-DQA2 (2)
- CD28 (1)
- ELANE (1)
- FCGR3A (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- HLA-DRB5 (1)