Primary Antibodies

View as table Download

Rabbit polyclonal antibody to LHR (luteinizing hormone/choriogonadotropin receptor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 622 and 699 of LHR (Uniprot ID#P22888)

Rabbit Polyclonal Anti-LHCGR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LHCGR / LHR / LH Receptor antibody was raised against synthetic 19 amino acid peptide from C-terminus of human hCG receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Rat, Dog, Panda (95%); Bovine, Bat, Rabbit, Horse (89%); Ferret (84%).

Rabbit polyclonal anti-LSHR antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LSHR.

Rabbit Polyclonal Anti-LHCGR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHCGR antibody is: synthetic peptide directed towards the C-terminal region of Human LHCGR. Synthetic peptide located within the following region: LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC