Primary Antibodies

View as table Download

Rabbit polyclonal NR1H3 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3.

Rabbit anti-NR1H3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR1H3

LXR alpha (NR1H3) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen NR1H3 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal LXR-A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LXR-A antibody was raised against a 15 amino acid peptide from near the amino terminus human LXR-A.

Rabbit Polyclonal Anti-NR1H3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA

LXR alpha (NR1H3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human LXRα, identical to the related rat and mouse sequence.

Rabbit Polyclonal Antibody against Liver X Receptor

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150).

Anti-NR1H3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 50-330 amino acids of human nuclear receptor subfamily 1, group H, member 3

Rabbit Polyclonal Anti-NR1H3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD