LXR alpha (NR1H3) Rabbit Polyclonal Antibody

CAT#: TA343557

Rabbit Polyclonal Anti-NR1H3 Antibody

Product Images

WB Suggested Anti-NR1H3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the N terminal of human NR1H3. Synthetic peptide located within the following region: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: nuclear receptor subfamily 1 group H member 3
• Database Link:
  NP_005684
  Entrez Gene 10062 Human
  UniProt ID Q13133
• Background: Interaction of NR1H3 with RXR shifts RXR from its role as a silent DNA-binding partner to an active ligand-binding subunit in mediating retinoid responses through target genes defined by LXRES. NR1H3 are DR4-type response elements characterized by direct repeats of two similar hexanuclotide half-sites spaced by four nucleotides. NR1H3 Plays an important role in the regulation of cholesterol homeostasis.
• Synonyms: LXR-a; LXRA; RLD-1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Goat: 85%; Bovine: 85%; Dog: 79%; Horse: 79%; Pig: 77%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: PPAR signaling pathway