Primary Antibodies

Jump to Filters
View as table Download
RICTOR Rabbit Polyclonal Antibody
TA308477

USD 415.00

5 Days

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)
RICTOR Rabbit Polyclonal Antibody
TA319016

USD 355.00

3 Weeks

Rabbit polyclonal anti-Rictor antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 1639 of mouse Rictor
RICTOR Rabbit Polyclonal Antibody
TA349591

USD 345.00

In Stock

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR
RICTOR Rabbit Polyclonal Antibody
TA357866

USD 360.00

5 Days

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG