RICTOR Rabbit Polyclonal Antibody

CAT#: TA357866

RICTOR Antibody

Product Images

Rabbit Anti-RICTOR antibody Catalog Number: ARP61411 Formalin Fixed Paraffin Embedded Tissue: Human Liver Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

• 

  Rabbit Anti-RICTOR antibody Catalog Number: ARP61411 Formalin Fixed Paraffin Embedded Tissue: Human Tonsil Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG
• Specificity: Expected reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
  Homology: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 100%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 192 kDa
• Gene Name: RPTOR independent companion of MTOR complex 2
• Database Link:
  NP_689969
  Entrez Gene 253260 Human
  UniProt ID Q6R327
• Background: RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008]
• Synonyms: AVO3; DKFZp686B11164; KIAA1999; mAVO3; MGC39830; PIA; pianissimo

Reference Data

• Protein Pathways: mTOR signaling pathway