Rabbit polyclonal Anti-Orexin Receptor 1
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RNWKRPSEQLEAQH, corresponding to amino acid residues 256-269 of rat OX1R . 3rd intracellular loop. |
Rabbit polyclonal Anti-Orexin Receptor 1
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RNWKRPSEQLEAQH, corresponding to amino acid residues 256-269 of rat OX1R . 3rd intracellular loop. |
Orexin Receptor 1 (HCRTR1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Orexin Receptor |
Rabbit polyclonal anti-HCRTR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HCRTR1. |
Orexin Receptor 1 (HCRTR1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 269-298 amino acids from the Central region of Human Orexin receptor type 1 (Center) |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Monkey, Rat |
Conjugation | Unconjugated |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Rabbit, Pig (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat (87%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig |
Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Horse, Pig (100%); Elephant, Bovine (94%); Marmoset, Panda (88%); Bat (81%). |
Rabbit Polyclonal Anti-HCRTR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCRTR1 antibody is: synthetic peptide directed towards the N-terminal region of Human HCRTR1. Synthetic peptide located within the following region: ATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYV |
Anti-HCRTR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1 |
Anti-HCRTR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1 |
HCRTR1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HCRTR1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HCRTR1 |
HCRTR1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HCRTR1 (NP_001516.2). |
Modifications | Unmodified |