Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1

Rabbit Polyclonal Anti-ZO 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZO 1 Antibody: A synthesized peptide derived from human ZO 1

Rabbit anti ZO-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1574 and 1748 of ZO-1 (Uniprot ID#Q07157)

Tjp1 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1

ZO-1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human ZO-1 (NP_003248.3).
Modifications Unmodified

ZO-1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human ZO-1 (NP_003248.3).
Modifications Unmodified