Rabbit anti-UBE2C Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2C |
Rabbit anti-UBE2C Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2C |
UBE2C (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human UBE2C |
Rabbit Polyclonal Anti-UBE2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the N terminal of human UBE2C. Synthetic peptide located within the following region: ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS |
Rabbit Polyclonal Anti-UBE2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2C antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP |
Rabbit Polyclonal Anti-UBE2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-UBE2C Antibody: synthetic peptide directed towards the middle region of human UBE2C. Synthetic peptide located within the following region: GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ |
UBE2C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2C |
UBE2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Recombinant Anti-UBE2C (Clone SAIC-41A-1)
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |