Primary Antibodies

View as table Download

Rabbit Monoclonal antibody against CD317 / BST2

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications Assay, IF, IHC, WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2]

Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA17

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA80

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA101

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772X122

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Rabbit Polyclonal Anti-CTNNB1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG