Primary Antibodies

View as table Download

Mouse Monoclonal H3K4me3 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

Mouse Monoclonal H3K4me1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Mouse Monoclonal H3K4me2 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Mouse Monoclonal H3K9me2 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

Mouse Monoclonal H3K9un Antibody

Applications Assay, IF, WB
Reactivities Human

Rabbit Polyclonal Anti-HIST2H2BF Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH