Germany
Japan
United Kingdom
China
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
Rabbit Polyclonal PDPK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal E-Cadherin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal APC Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
RAF1 (N-term) mouse monoclonal antibody, clone 540, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 863, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 163, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
USD 379.00
2 Weeks
EGF mouse monoclonal antibody, clone S-120, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- ELISA
Conjugates
- Unconjugated
Pathways
- Endometrial cancer
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Families
- Druggable Genome (70)
- Protein Kinase (42)
- ES Cell Differentiation/IPS (34)
- Transmembrane (24)
- Adult stem cells (20)
- Embryonic stem cells (12)
- Induced pluripotent stem cells (12)
- Stem cell relevant signaling - JAK/STAT signaling pathway (12)
- Cancer stem cells (10)
- Secreted Protein (10)
- Transcription Factors (10)
- Stem cell - Pluripotency (6)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Protease (1)