PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
PARP2 mouse monoclonal antibody, clone AT29G4, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-PARP2 Antibody
Applications | IF, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |