Primary Antibodies

Jump to Filters
View as table Download
PARP2 Mouse Monoclonal Antibody [Clone ID: AT29G4]
AM50055PU-S

USD 230.00

2 Weeks

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
PARP2 Mouse Monoclonal Antibody [Clone ID: AT29G4]
AM50055PU-N

USD 340.00

2 Weeks

PARP2 mouse monoclonal antibody, clone AT29G4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
PARP2 Rabbit Polyclonal Antibody
TA334262

USD 375.00

5 Days

Rabbit Polyclonal Anti-PARP2 Antibody

Applications IF, WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA