Primary Antibodies

Jump to Filters
View as table Download
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 370.00

2 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
LEF1 Rabbit Polyclonal Antibody
TA349379

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 424.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
c Kit (KIT) Rabbit Polyclonal Antibody
AP20497PU-N

USD 370.00

2 Weeks

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit.
LEF1 Rabbit Polyclonal Antibody
TA330286

USD 310.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ
c Kit (KIT) Rabbit Polyclonal Antibody
TA323712

USD 345.00

4 Weeks

Anti-KIT (phospho-Tyr936) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 936 (H-I-Y(p)-S-N) derived from Human c-Kit.
Modifications Phospho-specific
c Kit (KIT) Rabbit Polyclonal Antibody
AP09513PU-N

USD 300.00

2 Weeks

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit.
c Kit (KIT) Rabbit Polyclonal Antibody
AP09513PU-S

USD 230.00

2 Weeks

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen peptide sequence around amino acids 934~938 (H-I-Y-S-N) derived from Human c-kit.
BMP2 Rabbit Polyclonal Antibody
TA328271

USD 285.00

5 Days

Anti-Human BMP-2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human BMP-2
c Kit (KIT) Rabbit Polyclonal Antibody
TA350747

USD 345.00

In Stock

Rabbit Polyclonal Anti-KIT Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KIT