Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 35 of 35 results

(reset)

CBS Rabbit Polyclonal Antibody

TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications	IF, IHC, IP, WB
Reactivities	Human
Immunogen	Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CBS Rabbit Polyclonal Antibody

TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MAT1A Rabbit Polyclonal Antibody

TA346036

USD 410.00

5 Days

Rabbit Polyclonal Anti-MAT1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

1 / 2

2 / 2

Previous Next

BUD23 Rabbit Polyclonal Antibody

TA308485

USD 415.00

In Stock

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications	IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 3E1]

AM31730PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Rat

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6B8]

AM31731PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6A9]

AM31732PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 5F7]

AM31733PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

S adenosylhomocysteine hydrolase (AHCY) (N-term) Rabbit Polyclonal Antibody

AP50117PU-N

USD 450.00

2 Weeks

S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY

1 / 3

2 / 3

3 / 3

Previous Next

HEMK1 (C-term) Rabbit Polyclonal Antibody

AP52029PU-N

USD 450.00

2 Weeks

HEMK1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 311-338 amino acids from the C-terminal region of human HEMK1

1 / 2

2 / 2

Previous Next

AHCYL2 Rabbit Polyclonal Antibody

TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

1 / 3

2 / 3

3 / 3

Previous Next

LCMT2 Rabbit Polyclonal Antibody

TA319792

USD 430.00

5 Days

Rabbit Polyclonal TYW4 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

1 / 3

2 / 3

3 / 3

Previous Next

MAT1A (N-term) Rabbit Polyclonal Antibody

AP52613PU-N

USD 450.00

2 Weeks

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

1 / 2

2 / 2

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI3H10]

CF807109

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI7E8]

CF807112

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

CF807127

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

CF807130

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAPSS1 Rabbit Polyclonal Antibody

TA349567

USD 345.00

In Stock

Rabbit Polyclonal Anti-PAPSS1 Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human PAPSS1

CBS Rabbit Polyclonal Antibody

TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CBS

1 / 3

2 / 3

3 / 3

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI3H10]

TA807109

USD 379.00

In Stock

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H10]

TA807109AM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H10]

TA807109BM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI3H10]

TA807109S

USD 159.00

2 Days

PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI7E8]

TA807112

USD 379.00

In Stock

PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

PAPSS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7E8]

TA807112AM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), Biotinylated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7E8]

TA807112BM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8), HRP conjugated

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI7E8]

TA807112S

USD 159.00

2 Days

PAPSS2 mouse monoclonal antibody, clone OTI7E8 (formerly 7E8)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

TA807127

USD 379.00

In Stock

PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H10]

TA807127AM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody,clone OTI6H10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6H10]

TA807127BM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody,clone OTI6H10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI6H10]

TA807127S

USD 159.00

2 Days

PAPSS2 mouse monoclonal antibody,clone OTI6H10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

TA807130

USD 379.00

In Stock

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAPSS2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

TA807130AM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAPSS2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E7]

TA807130BM

USD 420.00

4 Weeks

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI2E7]

TA807130S

USD 159.00

2 Days

PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 35 of 35 results