Primary Antibodies

Jump to Filters
View as table Download
ARF1 Rabbit Polyclonal Antibody
TA346559

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
ARF1 Rabbit Polyclonal Antibody
TA308576

USD 415.00

In Stock

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 162 of ARF1 (Uniprot ID#P84077)
ARF1 Rabbit Polyclonal Antibody
TA308574

USD 415.00

5 Days

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 50 and 104 of ARF1
ARF1 Rabbit Polyclonal Antibody
TA323132

USD 345.00

In Stock

Anti-ARF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 100-115 amino acids of Human ADP-ribosylation factor 1
ARF1 Rabbit Polyclonal Antibody
TA383747

USD 380.00

4 Weeks

ARF1 Rabbit polyclonal Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ARF1