Rabbit anti-FTH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FTH1 |
Rabbit anti-FTH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FTH1 |
Ferritin Heavy Chain (FTH1) (221-232) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey |
Immunogen | Peptide from the C Terminus of the protein sequence according to NP_002023.2 |
Rabbit Polyclonal Anti-FTH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1. Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM |
Goat Anti-FTH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DKHTLGDSDNES, from the C Terminus of the protein sequence according to NP_002023.2. |
Anti-FTH1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-FTH1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |