Primary Antibodies

View as table Download

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LEF1

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Rabbit polyclonal EGFR-S1026 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026.

Rabbit polyclonal EGFR Antibody (S1070)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR.

Rabbit Polyclonal Anti-LEF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ

Rabbit polyclonal EGFR phospho Y1197 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein.

Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1).

Rabbit polyclonal EGFR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR antibody is generated from rabbits immunized with EGFR his fusion protein.

Anti-EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor