Primary Antibodies

Jump to Filters
View as table Download
IRF6 Rabbit Polyclonal Antibody
TA349362

USD 380.00

In Stock

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF6
IRF6 (455-467) Goat Polyclonal Antibody
AP22529PU-N

USD 440.00

2 Weeks

IRF6 (455-467) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from C-term of human IRF6
IRF6 Goat Polyclonal Antibody
TA302518

USD 375.00

5 Days

Goat Polyclonal Antibody against IRF6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TPSMQLPPALPPQ, from the C Terminus of the protein sequence according to NP_006138.
IRF6 Rabbit Polyclonal Antibody
TA329737

USD 375.00

5 Days

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6. Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ
FKBP6 Rabbit Polyclonal Antibody
TA356298

USD 300.00

5 Days

FKBP6 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FKBP6