Primary Antibodies

View as table Download

ANXA1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA1

Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen Peptide from the C Terminus of the protein sequence according to NP_000691.1

Rabbit polyclonal antibody to Annexin A1 (annexin A1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083)

Rabbit Polyclonal Anti-ANXA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Annexin A1 (ANXA1) (N-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen ANXA1 antibody was raised against synthetic peptide corresponding to N-terminal of human annexin I