Annexin A1 (ANXA1) Rabbit Polyclonal Antibody

CAT#: TA341644

Rabbit Polyclonal Anti-ANXA1 Antibody

Product Images

WB Suggested Anti-ANXA1 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

• 

  WB Suggested Anti-ANXA1 Antibody ; Positive Control: Lane 1: 20ug mouse fibroblast lysates; Primary Antibody Dilution : 1:600; Secondary Antibody : Anti rabbit-HRP; Secondry Antibody Dilution : 1:2000; Submitted by: Anonymous

• 

  Host: Rabbit; Target Name: ANXA1; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide ; Primary Antibody Concentration:2.5ug/mL; Peptide Concentration: 2.0ug/mL; Lysate Quantity: 25ug/lane; Gel Concentration: 12%

• 

  Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: annexin A1
• Database Link:
  NP_000691
  Entrez Gene 16952 MouseEntrez Gene 301 Human
  UniProt ID P04083
• Background: Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located onThe cytosolic face ofThe plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required forThe biosynthesis ofThe potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity. [provided by RefSeq, Jul 2008]
• Synonyms: ANX1; LPC1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 83%; Rat: 82%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome