Primary Antibodies

Jump to Filters
View as table Download
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA346050

USD 410.00

5 Days

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA371721

USD 380.00

4 Weeks

DDC rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDC
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA326643

USD 430.00

5 Days

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA375369

USD 220.00

3 Weeks

DDC Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DDC (NP_000781.1).
Modifications Unmodified