EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
EGFR L858R mouse monoclonal antibody,clone UMAB233
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-EGFR antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Mouse monoclonal EGFR Antibody
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit polyclonal EGFR Antibody (S1070)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR. |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit polyclonal EGFR phospho Y1197 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1). |
Rabbit polyclonal EGFR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR antibody is generated from rabbits immunized with EGFR his fusion protein. |
Mouse anti EGFR Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI6E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone OTI3F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGFR mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGFR mouse monoclonal antibody,clone OTI6E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody,clone OTI6E3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGFR mouse monoclonal antibody,clone OTI3F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody,clone OTI3F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
LEF1 mouse monoclonal antibody,clone OTI10A7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGFR mouse monoclonal antibody,clone UMAB95
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR mouse monoclonal antibody,clone UMAB95
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
EGFR mouse monoclonal antibody,clone UMAB95
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
EGFR L858R mouse monoclonal antibody,clone UMAB234
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB234
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EGFR L858R mouse monoclonal antibody,clone UMAB234
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".