Primary Antibodies

Jump to Filters
View as table Download
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA308162

USD 415.00

In Stock

Rabbit Polyclonal antibody to Arginase I (arginase, liver)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089)
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338396

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK
Arginase 1 (ARG1) Rabbit Polyclonal Antibody
TA338397

USD 310.00

5 Days

Rabbit Polyclonal Anti-ARG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF502413

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ARG1 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413

USD 379.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Arginase 1 (ARG1) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA502413S

USD 159.00

In Stock

ARG1 (liver Arginase) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated