Primary Antibodies

View as table Download

Mouse Monoclonal Rictor Antibody (7B3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
TA336802 is a replacement of AM06499SU-N.

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)

Goat Polyclonal Antibody against RICTOR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2.

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG

RICTOR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR