Rabbit Monoclonal Antibody against YAP1 (Clone EP1675Y) (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit Monoclonal Antibody against YAP1 (Clone EP1675Y) (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Mouse Monoclonal YAP1 Antibody (1A12)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against YAP1 (Clone EP1674Y)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
YAP1 mouse monoclonal antibody, clone 2F12
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
YAP1 mouse monoclonal antibody, clone 2H1
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-YAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-YAP1 antibody: synthetic peptide directed towards the C terminal of human YAP1. Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS |