Primary Antibodies

View as table Download

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

Rabbit Polyclonal GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3.

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit polyclonal anti-GATA3 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human GATA3.

GATA3 (2-14) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Bat, Canine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Sheep
Immunogen Synthetic peptide from the N-terminus of human GATA3 (NP_001002295.1; NP_002042.1)

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit Polyclonal anti-GATA3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3. Synthetic peptide located within the following region: MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVC

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody, clone OTI10G7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GATA3 mouse monoclonal antibody, clone OTI5C11 (formerly 5C11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GATA3 mouse monoclonal antibody, clone OTI8H4 (formerly 8H4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 mouse monoclonal antibody, clone OTI10G7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA3 mouse monoclonal antibody, clone OTI10G7, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GATA3 mouse monoclonal antibody, clone OTI10G7, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GATA3 mouse monoclonal antibody, clone OTI10G7

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GATA3 mouse monoclonal antibody,clone UMAB218

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GATA3 mouse monoclonal antibody,clone UMAB218

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATA3 mouse monoclonal antibody,clone UMAB218

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".