Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KCNK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KCNK1.

Mouse Monoclonal anti-KCNC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-KCNT1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human KCNT1.

Rabbit Polyclonal KCNK13 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK13 antibody was raised against a 15 amino acid synthetic peptide near the center of human KCNK13.

Mouse Monoclonal anti-slo1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Rabbit polyclonal Potassium Channel Kv3.2b antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Potassium Channel Kv3.2b.

Rabbit Polyclonal KCNK12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12.

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

Rabbit Polyclonal Anti-KCNJ15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ15

Rabbit Polyclonal TRESK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRESK antibody was raised against a 17 amino acid peptide from near the center of human TRESK.

Rabbit polyclonal Kir5.1 (Ab-416) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Kir5.1 around the phosphorylation site of serine 416 (M-E-SP-Q-M).

Rabbit Polyclonal Anti-K2P1.1 (TWIK-1) (extracellular)

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide RQELRKLKRRFLEEHEC, corresponding to amino acid residues 53-69 of human K2P1.1.Extracellular, near the P1 loop.

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%).

Mouse monoclonal KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal KCNQ4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal KCNQ2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse monoclonal Kv1.3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-KCNH2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human KCNH2

Rabbit Polyclonal Anti-KCa2.3 (SK3) (N-term)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide DTSGHFHDSGVGDLDEDPKC, corresponding to amino acid residues 2-21 of human KCa2.3 (SK3). Intracellular, N-terminus.

Rabbit Polyclonal Anti-KCNN3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA

Rabbit Polyclonal Anti-KCNQ2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH

Rabbit Polyclonal Anti-KCNQ2 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL

Rabbit Polyclonal Anti-KCNQ2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)

Applications IHC
Reactivities Human: Thr246, Mouse: Thr247, Rat: Thr247
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K).
Modifications Phospho-specific

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%).

KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%).

Mouse Monoclonal Anti-Kv1.2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation Unconjugated

Mouse Monoclonal Anti-Kv1.6 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-KCNA1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)

Anti-KCNH8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8

Anti-KCNH8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8

Anti-KCNC2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2

Anti-KCNH3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3

Anti-KCNC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1

Rabbit Polyclonal Anti-KCNJ11 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNJ11

Rabbit Polyclonal Anti-KCNK1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNK1

Rabbit Polyclonal Anti-KCNK13 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNK13

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1

Rabbit Polyclonal Anti-KCNQ5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ5

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1

Rabbit Polyclonal Anti-KCNJ6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ6

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9

Rabbit Polyclonal Anti-KCNA7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA7

Rabbit Polyclonal Anti-KCND1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCND1

Rabbit Polyclonal Anti-KCNG1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNG1