Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
| Modifications | Phospho-specific |
Anti-NODAL Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig |
| Immunogen | NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%). |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit Polyclonal anti-DLX2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the N terminal of human DLX2. Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP |
Rabbit Polyclonal Anti-DLX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the C terminal of human DLX2. Synthetic peptide located within the following region: PASWDFGVPQRMAGGGGPGSGGSGAGSSGSSPSSAASAFLGNYPWYHQTS |
Rabbit Polyclonal Anti-BMP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
BMP8B rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
GDF9 Rabbit Polyclonal (aa45-59) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GDF9 / GDF-9 antibody was raised against synthetic peptide from human GDF9. |
Rabbit Polyclonal BMP15 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal BMP15 antibody was raised against an 18 amino acid peptide near the amino terminus of human BMP15. |
Anti-Human BMP-2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BMP-2 |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-BMP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-SMAD5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5 |
Rabbit Polyclonal Anti-SMAD3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMAD3 |
Rabbit Polyclonal Anti-BMP6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human BMP6 |
c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
2 Weeks
USD 420.00
2 Weeks
c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Applications
- IHC
Families
- Stem cell relevant signaling - TGFb/BMP signaling pathway
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- TGF-beta signaling pathway (111)
- Pathways in cancer (59)
- Cell cycle (50)
- Colorectal cancer (50)
- Wnt signaling pathway (50)
- Chronic myeloid leukemia (44)
- Acute myeloid leukemia (35)
- Bladder cancer (32)
- Endometrial cancer (32)
- ErbB signaling pathway (32)
- Jak-STAT signaling pathway (32)
- MAPK signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Adherens junction (18)
- Pancreatic cancer (18)
- Hedgehog signaling pathway (17)
- Basal cell carcinoma (9)
- Cytokine-cytokine receptor interaction (7)
- Endocytosis (3)
- Hematopoietic cell lineage (3)
- Melanogenesis (3)