Primary Antibodies

View as table Download

Rabbit Polyclonal anti-GAS7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GAS7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 184-382 amino acids of human growth arrest-specific 7

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".