Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 19 of 19 results

(reset)

NR0B2 Rabbit Polyclonal Antibody

TA308392

USD 415.00

In Stock

Rabbit Polyclonal antibody to NR0B2 (nuclear receptor subfamily 0, group B, member 2)

Applications	IF, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 64 and 257 of NR0B2 (Uniprot ID#Q15466)

1 / 2

2 / 2

Previous Next

NR0B2 (Center) Rabbit Polyclonal Antibody

AP52928PU-N

USD 450.00

2 Weeks

NR0B2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 56-83 amino acids from the Central region of human NR0B2

1 / 3

2 / 3

3 / 3

Previous Next

NR0B2 Rabbit Polyclonal Antibody

TA338004

USD 375.00

5 Days

Rabbit Polyclonal Anti-NR0B2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-NR0B2 antibody: synthetic peptide directed towards the middle region of human NR0B2. Synthetic peptide located within the following region: AEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSL

1 / 2

2 / 2

Previous Next

NR0B2 Rabbit Polyclonal Antibody

TA340514

USD 425.00

5 Days

Rabbit Polyclonal Anti-NR0B2 Antibody (Ligand-binding Domain)

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	NR0B2 / SHP antibody was raised against synthetic 16 amino acid peptide from ligand-binding domain of human NR0B2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Hamster, Rabbit (100%); Rat, Bovine, Bat (94%); Elephant, Panda, Horse, Pig, Opossum (88%); Dog (81%).

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI5F10]

CF806319

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI7B5]

CF806321

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI8E5]

CF806345

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI5F10]

TA806319

USD 379.00

In Stock

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NR0B2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F10]

TA806319AM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NR0B2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]

TA806319BM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI5F10]

TA806319S

USD 159.00

2 Days

NR0B2 mouse monoclonal antibody, clone OTI5F10 (formerly 5F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI7B5]

TA806321

USD 379.00

In Stock

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

NR0B2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7B5]

TA806321AM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

NR0B2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7B5]

TA806321BM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI7B5]

TA806321S

USD 159.00

2 Days

NR0B2 mouse monoclonal antibody, clone OTI7B5 (formerly 7B5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 21

2 / 21

3 / 21

4 / 21

5 / 21

6 / 21

7 / 21

8 / 21

9 / 21

10 / 21

11 / 21

12 / 21

13 / 21

14 / 21

15 / 21

16 / 21

17 / 21

18 / 21

19 / 21

20 / 21

21 / 21

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI8E5]

TA806345

USD 379.00

In Stock

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

NR0B2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E5]

TA806345AM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

NR0B2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E5]

TA806345BM

USD 420.00

4 Weeks

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI8E5]

TA806345S

USD 159.00

2 Days

NR0B2 mouse monoclonal antibody, clone OTI8E5 (formerly 8E5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 19 of 19 results