Primary Antibodies

Jump to Filters
View as table Download
Diazepam Binding Inhibitor (DBI) Rabbit Polyclonal Antibody
TA332222

USD 375.00

5 Days

Rabbit Polyclonal Anti-DBI Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DBI Antibody: synthetic peptide directed towards the N terminal of human DBI. Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
Diazepam Binding Inhibitor (DBI) Rabbit Polyclonal Antibody
TA375333

USD 220.00

3 Weeks

DBI Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human DBI (NP_001171513.1).
Modifications Unmodified