Diazepam Binding Inhibitor (DBI) Rabbit Polyclonal Antibody

CAT#: TA332222

Rabbit Polyclonal Anti-DBI Antibody

Product Images

WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Liver

• 

  Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DBI Antibody: synthetic peptide directed towards the N terminal of human DBI. Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 10 kDa
• Gene Name: diazepam binding inhibitor, acyl-CoA binding protein
• Database Link:
  NP_065438
  Entrez Gene 1622 Human
  UniProt ID P07108
• Background: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.
• Synonyms: ACBD1; ACBP; CCK-RP; EP
• Note: Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: PPAR signaling pathway