Primary Antibodies

Jump to Filters
View as table Download
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346200

USD 475.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Prothrombin (F2) Rabbit Polyclonal Antibody
TA351802

USD 345.00

In Stock

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2
F2 Rabbit Polyclonal Antibody
TA367311

USD 380.00

4 Weeks

F2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2