Primary Antibodies

View as table Download

Goat Polyclonal Anti-PRDM1 / MEL1 Antibody

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRDM1 / MEL1 Antibody: Peptide with sequence C-DISDNADRLEDVED, from the internal region of the protein sequence according to NP_001189.2; NP_878911.1.

Rabbit Polyclonal Blimp-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Blimp-1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human Blimp-1.

Rat Anti-Human/Mouse Blimp1 Purified (25 ug)

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-PRDM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM1 antibody: synthetic peptide directed towards the middle region of human PRDM1. Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES