Primary Antibodies

Jump to Filters
View as table Download
TJP1
AB0054-200

USD 320.00

In Stock

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.
TJP1 Rabbit Polyclonal Antibody
TA341679

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-TJP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TJP1 antibody: synthetic peptide directed towards the middle region of human TJP1. Synthetic peptide located within the following region: QNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQASRDLEQPTYRYESS
TJP1 Rabbit Polyclonal Antibody
TA308455

USD 415.00

5 Days

Rabbit polyclonal antibody to ZO-1 (tight junction protein 1 (zona occludens 1))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 296 of ZO-1 (Uniprot ID#Q07157)
TJP1 Rabbit Polyclonal Antibody
TA372843

USD 380.00

4 Weeks

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1
TJP1 Rabbit Polyclonal Antibody
TA368609

USD 380.00

4 Weeks

TJP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TJP1
TJP1 Rabbit Polyclonal Antibody
TA382552

USD 220.00

3 Weeks

ZO-1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1600-1700 of human ZO-1 (NP_003248.3).
Modifications Unmodified